PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_246142g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 203aa    MW: 22932.1 Da    PI: 8.5014
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_246142g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+  ++ +G g W++ ++  g+ R++k+c++rw +yl
   MA_246142g0010 14 KGAWTKEEDHRLIAHIRTHGEGGWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.72e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE el+++++   G++ W++Ia +++ gRt++++k++w+++
   MA_246142g0010  67 RGSFTEEENELIIKLHSVVGNK-WSLIAGRFP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129414.577961IPR017930Myb domain
SuperFamilySSF466893.74E-2913108IPR009057Homeodomain-like
SMARTSM007171.2E-101363IPR001005SANT/Myb domain
PfamPF002495.5E-141461IPR001005SANT/Myb domain
CDDcd001671.02E-81661No hitNo description
PROSITE profilePS5129426.60462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2765116IPR009057Homeodomain-like
SMARTSM007172.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1467111IPR001005SANT/Myb domain
CDDcd001674.61E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDHRLIAHIR THGEGGWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGSF TEEENELIIK LHSVVGNKWS LIAGRFPGRT DNEIKNYWNT HIKKKLLSKG  120
LDPQTHCPLG QPYNSNNTSV SRPAPDHEIP GFQNPRTPEI ADFFQRDRSE SSPIESAASD  180
LEEHSDLNLN LCISLPSXXX ICA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1990420.0HM199042.1 Picea sitchensis isolate CR201 myb-like protein mRNA, partial cds.
GenBankHM1990430.0HM199043.1 Picea sitchensis isolate CR300 myb-like protein mRNA, partial cds.
GenBankHM1990450.0HM199045.1 Picea sitchensis isolate CR400 myb-like protein mRNA, partial cds.
GenBankHM1990460.0HM199046.1 Picea sitchensis isolate CR401 myb-like protein mRNA, partial cds.
GenBankHM1990470.0HM199047.1 Picea sitchensis isolate KD100 myb-like protein mRNA, partial cds.
GenBankHM1990500.0HM199050.1 Picea sitchensis isolate KD201 myb-like protein mRNA, partial cds.
GenBankHM1990520.0HM199052.1 Picea sitchensis isolate KD301 myb-like protein mRNA, partial cds.
GenBankHM1990550.0HM199055.1 Picea sitchensis isolate PR100 myb-like protein mRNA, partial cds.
GenBankHM1990560.0HM199056.1 Picea sitchensis isolate PR101 myb-like protein mRNA, partial cds.
GenBankHM1990570.0HM199057.1 Picea sitchensis isolate PR200 myb-like protein mRNA, partial cds.
GenBankHM1990590.0HM199059.1 Picea sitchensis isolate PR300 myb-like protein mRNA, partial cds.
GenBankHM1990600.0HM199060.1 Picea sitchensis isolate PR301 myb-like protein mRNA, partial cds.
GenBankHM1990620.0HM199062.1 Picea sitchensis isolate PR401 myb-like protein mRNA, partial cds.
GenBankHM1990640.0HM199064.1 Picea sitchensis isolate RW101 myb-like protein mRNA, partial cds.
GenBankHM1990650.0HM199065.1 Picea sitchensis isolate RW200 myb-like protein mRNA, partial cds.
GenBankHM1990670.0HM199067.1 Picea sitchensis isolate RW300 myb-like protein mRNA, partial cds.
GenBankHM1990690.0HM199069.1 Picea sitchensis isolate RW400 myb-like protein mRNA, partial cds.
GenBankHM1990710.0HM199071.1 Picea sitchensis isolate VA100 myb-like protein mRNA, partial cds.
GenBankHM1990850.0HM199085.1 Picea sitchensis isolate VD400 myb-like protein mRNA, partial cds.
GenBankHM1990860.0HM199086.1 Picea sitchensis isolate VD401 myb-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826645.13e-89PREDICTED: myb-related protein 308
SwissprotQ9SZP17e-84MYB4_ARATH; Transcription repressor MYB4
TrEMBLE0Z8W71e-132E0Z8W7_PICSI; Myb-like protein (Fragment)
TrEMBLE0Z8U61e-132E0Z8U6_PICSI; Myb-like protein (Fragment)
TrEMBLE0Z8W31e-132E0Z8W3_PICSI; Myb-like protein (Fragment)
STRINGPGSC0003DMT4000158032e-85(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-85myb domain protein 4